IGF-1 DES (1mg)

(21 customer reviews)

$95.00

IGF-1 DES peptides are Synthesized and Lyophilized in the USA.

Discount per Quantity

Quantity 5 - 910 +
Discount 5%10%
Price $90.25$85.50
Orders over $200 receive:
FREE - 30ml bottle of bacteriostatic water
(Required for reconstitution)
FREE - USPS priority shipping
SKU: IGF-1-DES-1mg Category:

Description

IGF-1 DES Peptide

IGF-1 DES is a form of insulin-like growth factor-1 (IGF-1). In this peptide, the N-terminal sequence comprising Glycine-Proline-Glutamine is missing, potentially assisting it in its alleged resistance to specific inhibitors. Researchers have reported the peptide to exhibit up to ten times greater potency than the untruncated version of the compound, with published observations in hypertrophy and cellular growth research studies.[1] Researchers report that “The increased potency is retained … with selective anabolic effects particularly evident in gut tissues.” It also appears to induce anabolism in catabolic conditions such as those seen during chronic illnesses, and the peptide has been examined in the course of inflammatory bowel disease (IBD) research, and studies in certain neurological and neurodevelopmental disorders like autism.

Researchers have speculated that the peptide may have a low binding capacity to IGF-1 binding proteins (IGFBPs), and that has led them to hypothesize that IGF-1 DES may be 2-3 times more potent than IGF-1 in lowering blood sugar. The peptide may also exhibit neuroprotective and anabolic characteristics, posited by research findings on skeletal muscle cells. It appears to exhibit desirable characteristics of faster clearance from the circulation and quicker and higher peak activity.

Specifications

Other Known Titles: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA

Molecular Formula: C319H495N91O96S7

Molecular Weight: 7365.4225 g/mol

IGF-1 DES Research

IGF-1 DES and Neurological Disease
IGF-1 appears to aid in promoting neuronal growth and differentiation. This may be achieved through synaptic formation, which the peptide appears to enable and support. Researchers suggest that IGF-1 DES may promote the formation of mature synapses as well as their maintenance. More precisely, they may help maintain desired concentrations of presynaptic synapsin-1 protein and post-synaptic PSD-95 protein. These molecules appear to regulate the neurotransmitters released and synaptic structure maintenance, which may adversely affect motor skills, behavior, cognitive functioning, and language development. Research studies suggest that in cases of ALS, IGF-1 exposure may limit disease progression and improve muscular strength and lung functioning. It may also may exert a protective effect on dopaminergic neurons and improve behavioral patterns in research models of Parkinson’s Disease.[2] In addition, IGF-1 DES appears to have the potential to preserve neuron density and excitatory synapses in the brains of Rett syndrome and chromosome 22 deletion syndrome research models.

IGF-1 DES and Autism
IGF-1 analogs have been suggested by researchers to exhibit possible impacts on synapses, encouraging interest in researchers studying disorders caused by disruptions in synaptic development. These include autism, fragile X syndrome, tuberous sclerosis, and Angelman syndrome. Low IGF-1 concentrations in the brain have been associated with faulty development and progression of autism.[3] However, IGF-II and analogs like IGF-1 DES may potentially reverse these events, improve social interaction, novel-object recognition, contextual fear conditioning, reduce obsessive behavioral patterns, and improve grooming and memory.

IGF-1 DES and Cognition
With increasing age, the levels of IGF-1 in the brain decline, negatively impacting learning and memory recall functions. Ongoing research suggests that exposure to IGF-1 DES may potentially improve excitatory post-synaptic potential by ~40%, suggesting the peptide’s potential to impact cognitive function, particularly in age-related synaptic dysfunction.[4] The scientists reported that “the acute actions of des-IGF-1 at hippocampal excitatory synapses may provide insight into the mechanism by which long-term increases in plasma IGF-1 impart cognitive benefits in aged rats.” Moreover, IGF-1 DES appears to have better penetration power across the blood-brain barrier than the untruncated protein, making the peptide potentially better positioned to support synaptic transmission.

IGF-1 DES and Immune Function
IGF-1 receptors are considered to be present on the surface of mononuclear cells and neutrophils.[5] Recent findings have suggested that IGF-1 DES may encourage hydrogen peroxide release from mononuclear cells and support neutrophils to mature into pathogen-killing blastocytes.[6] These impacts may potentially improve immune function, though specific and focused research is necessary to understand any action that the peptide might have.

IGF-1 DES and Wound Healing
Fibroblast cells present in the dermal layer are considered responsible for tissue repair in case of injury. This may be affected by certain IGFBPs that bind and reduce the impact of IGF-1 at its other receptors.[7] Certain inflammatory cytokines may potentially alter IGFBP levels, which may impact healing. However, by introducing IGF-1 DES, which appears to remain unaffected by IGFBP, it may be easier to overcome the hurdles induced by inflammatory cytokines. The resultant improvement in fibroblast growth and differentiation may hasten tissue repair.

IGF-1 DES and Cancer Cells
Cancerous cells in undifferentiated or early stages of differentiation are difficult to mitigate and are dysfunctional, whereas cells in more differentiated stages appear to grow more slowly. IGF-1 DES may possibly retard cancer cell growth by promoting the differentiation of certain types of cancerous cells. IGF-1 DES is different from IGF-1 as it does not appear to bind to IGFBPs, which apparently allows these peptides to cross the blood-brain barrier under certain conditions. Studies suggest its potential in skeletal muscle and neuronal growth, neuronal development, and tissue repair. Its potential relevancy in disorders caused from stroke, cancer, neurological factors, and the like, are also being researched.

Disclaimer: The products mentioned are not intended for human or animal consumption. Research chemicals are intended solely for laboratory experimentation and/or in-vitro testing. Bodily introduction of any sort is strictly prohibited by law. All purchases are limited to licensed researchers and/or qualified professionals. All information shared in this article is for educational purposes only.

 

References

  1. Ballard FJ, Wallace JC, Francis GL, Read LC, Tomas FM. Des(1-3)IGF-I: a truncated form of insulin-like growth factor-I. Int J Biochem Cell Biol. 1996 Oct;28(10):1085-7. doi: 10.1016/1357-2725(96)00056-8. PMID: 8930132.
  2. Ghazi Sherbaf F, Mohajer B, Ashraf-Ganjouei A, Mojtahed Zadeh M, Javinani A, Sanjari Moghaddam H, Shirin Shandiz M, Aarabi MH. Serum Insulin-Like Growth Factor-1 in Parkinson’s Disease; Study of Cerebrospinal Fluid Biomarkers and White Matter Microstructure. Front Endocrinol (Lausanne). 2018 Nov 2;9:608. doi: 10.3389/fendo.2018.00608. PMID: 30450079; PMCID: PMC6224341.
  3. Riikonen R. Insulin-Like Growth Factors in the Pathogenesis of Neurological Diseases in Children. Int J Mol Sci. 2017 Sep 26;18(10):2056. doi: 10.3390/ijms18102056. PMID: 28954393; PMCID: PMC5666738.
  4. Ramsey MM, Adams MM, Ariwodola OJ, Sonntag WE, Weiner JL. Functional characterization of des-IGF-1 action at excitatory synapses in the CA1 region of rat hippocampus. J Neurophysiol. 2005 Jul;94(1):247-54. doi: 10.1152/jn.00768.2004. PMID: 15985695.
  5. Ni F, Sun R, Fu B, Wang F, Guo C, Tian Z, Wei H. IGF-1 promotes the development and cytotoxic activity of human NK cells. Nat Commun. 2013;4:1479. doi: 10.1038/ncomms2484. PMID: 23403580; PMCID: PMC3586714.
  6. Zhao X, McBride BW, Trouten-Radford LM, Burton JH. Effects of insulin-like growth factor-I and its analogues on bovine hydrogen peroxide release by neutrophils and blastogenesis by mononuclear cells. J Endocrinol. 1993 Nov;139(2):259-65. doi: 10.1677/joe.0.1390259. PMID: 7508487.
  7. Sureshbabu A, Okajima H, Yamanaka D, Shastri S, Tonner E, Rae C, Szymanowska M, Shand JH, Takahashi S, Beattie J, Allan GJ, Flint DJ. IGFBP-5 induces epithelial and fibroblast responses consistent with the fibrotic response. Biochem Soc Trans. 2009 Aug;37(Pt 4):882-5. doi: 10.1042/BST0370882. PMID: 19614612.
All orders ship same day if placed by 12 PST.
This product is strictly for research/laboratory use only.  Human or animal use and/or consumption is strictly prohibited by law.  Only qualified and licensed professionals should handle these products.  Any information found on Biotech Peptides is strictly for educational purposes only.  Refer to our terms and conditions for more details.

Additional information

Brand

Biotech Peptides

21 reviews for IGF-1 DES (1mg)

  1. Justin Brand

    You guys are the best!

  2. Colson Winslet

    10/10

  3. Chase Nelson

    Not enough words to express how pleased I am with everything about the experience of buying from Biotech

  4. Juliet Wolf

    For some reason, I expected the products to be a whole lot bigger lol. Probably because of the pictures, but they’re the perfect size

  5. Cora Strand

    I like to do research on companies before I do business with them. So far, I would highly recommend Biotech Peptides to any researcher or company! Products are pure and true!

  6. Ethan Carpio

    Stunning service

  7. Jeffrey Cole

    Ten out of ten would recommend

  8. Carlos Berry

    A very trustworthy company. You can order stress-free

  9. Patty Branco

    Very high quality products. A great find for sure. Definitely making these guys my only supplier.

  10. Oliver Singh

    I am not really the one to leave reviews, but this company deserves all the praise it can get.

  11. Alexis Ogelio

    HAVE BOUGHT PEPTIDES FROM OTHER SOURCES BEFORE THEY CARRY THE BEST IN MY OPINION.

  12. Amber Krauss

    I called them three times and it seemed like they were busy. I called a fourth time a little while after my last try and got a hold of someone named Danni. They explained they have been getting a lot of calls because like me the packages are lost. Hope they change the company they use because this is a big mess and headache for them. Anyway, They are resending all orders with expedited shipping. Fingers crossed I get it in time.

  13. Charlie W. Simons

    Everything came in safe and sound. No broken containers or vials. Nothing looked tampered with or ruined. Wish they had a label on the box however so I knew what the package was initally.

  14. Steve Hogen

    I appreciate how they have articles on their blog about all products they have in stock. Nice way of discovering new peptides.

  15. Malcolm Allen

    Best deal I have found.

  16. David Harold

    Everything came in as advertised and when they said it would be delivered.

  17. burt felix

    Products are amazing, purest I have found thus far. Been working with peptides for a few years now and It’s hard to come by good legit peptides that are also reasonably priced.

  18. Steven robertson

    Good prices for peptides and if you store it correctly these peptides will last for a while.

  19. David Bird

    Orders just came in. Surprised at how fast they arrived as I am based in the east coast!

  20. Bryan Hogan

    Danny and Taylor are my go to for anything.

  21. Jack McLain

    Return time is great! Never a long wait for a response. Danny reached out to me in no time after I sen an e-mail regarding a few missing peptides from my order.

Add a review