No products in the cart
IGF-1 DES (1mg)
$89.00
IGF-1 DES peptides are Synthesized and Lyophilized in the USA.
Discount per Quantity
Quantity | 5 - 9 | 10 + |
---|---|---|
Discount | 5% | 10% |
Price | $84.55 | $80.10 |
FREE - 30ml bottle of bacteriostatic water
(Required for reconstitution)
FREE - USPS priority shipping
Description
What is the IGF-1 DES Peptide?
IGF-1 DES is a form of insulin-like growth factor-1 (IGF-1). In this peptide, the N-terminal sequence comprising Glycine-Proline-Glutamine is missing, assisting it in its potential to be resistant to certain inhibitors, and increasing its bioavailability. It is reported to exhibit a ten times greater potency than the untruncated version, with roles in hypertrophy and cellular growth research.[1] The researchers report that “The increased potency is retained in part when the variant is administered in vivo, with selective anabolic effects particularly evident in gut tissues.” It also appears to induce anabolism in catabolic conditions such as those seen during chronic illnesses, as an anti-inflammatory agent against inflammatory bowel disease (IBD), and also certain neurological and neurodevelopmental disorders like autism.
Specifications
AKA: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
Molecular Formula: C319H495N91O96S7
Molecular Weight: 7365.4225 g/mol
PubChem: 135331146
CAS Number: 112603-35-7
Reconstitution: Required
IGF-1 DES vs. IGF-1
Due to its low binding capacity to IGF-1 binding proteins (IGFBPs), IGF-1 DES may be 2-3 times more potent than IGF-1 in lowering blood sugar, may also exhibit neuroprotective properties and potential anabolic effects on skeletal muscle cells. It appears to have the desirable qualities of faster clearance from the circulation and quicker and higher peak activity. These properties make it a potentially desirable option for controlling hyperglycemic conditions so that effects similar to insulin administration may be achieved without the long-term side effects associated with higher doses. Of note, the anabolic effects of IGF-1 DES appear to occur even when the calorie intake is limited, resulting in significant improvements in body weight, nitrogen retention, and food conversion efficiency.
Research
IGF-1 DES and Neurological Disease
IGF-1 aids in promoting neuronal growth and differentiation as well as viability. This is achieved by its ability to promote the synaptic formation, enabling better memory retention. Researchers suggest that IGF-1 DES may similarly promote the formation of mature synapses as well as their maintenance. More precisely, they may help maintain desired concentrations of presynaptic synapsin-1 protein and post-synaptic PSD-95 protein. These molecules appear to regulate the neurotransmitters released and synaptic structure maintenance, which adversely affect motor skills, behavior, cognitive functioning, and language development. Clinical trials suggest that in ALS patients, IGF-1 administration limits disease progression and improves muscular strength and lung functioning. They also may have a protective effect on dopaminergic neurons and improve behavioral patterns in Parkinson’s Disease patients.[2] In addition, IGF-1 DES appears to have the potential to help in preserving the neuron density and number of excitatory synapses in the brain in patients of Rett syndrome and chromosome 22 deletion syndrome. These peptides may also reduce the toxic effects of NDMA over-stimulation and resultant neuronal death by protecting neurons from excitotoxicity.
IGF-1 DES and Autism
IGF-1 analogs have been suggested by researchers to exhibit potent effects on synapses, making them potential ideal therapeutic choices for disorders caused by disruptions in synaptic development. These include autism, fragile X syndrome, tuberous sclerosis, and Angelman syndrome. Low IGF-1 concentrations in the brain have been associated with faulty development and progression of autism.[3] However, IGF-II and analogs like IGF-1 DES may reverse these events, improve social interaction, novel-object recognition, contextual fear conditioning, reduce obsessive behavioral patterns, and improve grooming and memory.
IGF-1 DES and Cognition
With increasing age, the levels of IGF-1 in the brain decline, affecting learning and memory negatively. Ongoing research suggests that administering IGF-1 DES improves excitatory post-synaptic potential significantly by ~40%, suggesting the peptide’s potential to benefit cognitive function, particularly in age-related synaptic dysfunction.[4] The scientists reported that “the acute actions of des-IGF-1 at hippocampal excitatory synapses may provide insight into the mechanism by which long-term increases in plasma IGF-1 impart cognitive benefits in aged rats.” Moreover, IGF-1 DES appears to have better penetration power across the blood-brain barrier than the untruncated protein, making them potentially better at enhancing synaptic transmission. This potential would make them more effective in protecting neurons and reducing neuronal death, thereby protecting against neurological diseases, stroke, Alzheimer’s disease, or Parkinson’s disease.
IGF-1 DES and Immune Function
IGF-1 receptors are present on the surface of mononuclear cells and neutrophils.[5] Recent findings have suggested that IGF-1 DES may boost hydrogen peroxide release from mononuclear cells and encourage neutrophils to mature into pathogen-killing blastocytes.[6] These effects may improve immune function, bringing their potential as an effective adjuvant to antibiotics for inducing immunity against infectious diseases.
IGF-1 DES and Wound Healing
Fibroblast cells present in the dermal layer are responsible for tissue repair in case of any injury. This can be affected by various IGFBPs that bind and reduce the effect of IGF-1 at its other receptors.[7] Certain inflammatory cytokines can also alter IGFBP levels, which may impact healing. However, by administering IGF-1 DES, which appears to remain unaffected by IGFBP, it may be easier to overcome these hurdles induced by inflammatory cytokines. The resultant improvement in fibroblast growth and differentiation would hasten wound healing.
IGF-1 DES and Cancer
Cancerous cells in undifferentiated or early stages of differentiation are difficult to treat and dysfunctional, whereas cells in more differentiated stages grow more slowly. IGF-1 DES may slow cancer growth by promoting the differentiation of certain types of cancerous cells. IGF-1 DES is different from IGF-1 as it does not bind to IGFBPs, apparently allowing these peptides to cross the blood-brain barrier upon exogenous administration. Studies suggest its potential in skeletal muscle and neuronal growth, neuronal development, and wound healing. Applications in disorders caused due to stroke, cancer, autism, and the like are also being researched. Researchers report IGF-1 DES may result in some side effects and possesses low oral and excellent subcutaneous bioavailability, as seen in mice models. The per kg dosage in mice does not apply to humans.
References
- Ballard FJ, Wallace JC, Francis GL, Read LC, Tomas FM. Des(1-3)IGF-I: a truncated form of insulin-like growth factor-I. Int J Biochem Cell Biol. 1996 Oct;28(10):1085-7. doi: 10.1016/1357-2725(96)00056-8. PMID: 8930132.
- Ghazi Sherbaf F, Mohajer B, Ashraf-Ganjouei A, Mojtahed Zadeh M, Javinani A, Sanjari Moghaddam H, Shirin Shandiz M, Aarabi MH. Serum Insulin-Like Growth Factor-1 in Parkinson’s Disease; Study of Cerebrospinal Fluid Biomarkers and White Matter Microstructure. Front Endocrinol (Lausanne). 2018 Nov 2;9:608. doi: 10.3389/fendo.2018.00608. PMID: 30450079; PMCID: PMC6224341.
- Riikonen R. Insulin-Like Growth Factors in the Pathogenesis of Neurological Diseases in Children. Int J Mol Sci. 2017 Sep 26;18(10):2056. doi: 10.3390/ijms18102056. PMID: 28954393; PMCID: PMC5666738.
- Ramsey MM, Adams MM, Ariwodola OJ, Sonntag WE, Weiner JL. Functional characterization of des-IGF-1 action at excitatory synapses in the CA1 region of rat hippocampus. J Neurophysiol. 2005 Jul;94(1):247-54. doi: 10.1152/jn.00768.2004. PMID: 15985695.
- Ni F, Sun R, Fu B, Wang F, Guo C, Tian Z, Wei H. IGF-1 promotes the development and cytotoxic activity of human NK cells. Nat Commun. 2013;4:1479. doi: 10.1038/ncomms2484. PMID: 23403580; PMCID: PMC3586714.
- Zhao X, McBride BW, Trouten-Radford LM, Burton JH. Effects of insulin-like growth factor-I and its analogues on bovine hydrogen peroxide release by neutrophils and blastogenesis by mononuclear cells. J Endocrinol. 1993 Nov;139(2):259-65. doi: 10.1677/joe.0.1390259. PMID: 7508487.
- Sureshbabu A, Okajima H, Yamanaka D, Shastri S, Tonner E, Rae C, Szymanowska M, Shand JH, Takahashi S, Beattie J, Allan GJ, Flint DJ. IGFBP-5 induces epithelial and fibroblast responses consistent with the fibrotic response. Biochem Soc Trans. 2009 Aug;37(Pt 4):882-5. doi: 10.1042/BST0370882. PMID: 19614612.
Dr. Usman (BSc, MBBS, MaRCP) completed his studies in medicine at the Royal College of Physicians, London. He is an avid researcher with more than 30 publications in internationally recognized peer-reviewed journals. Dr. Usman has worked as a researcher and a medical consultant for reputable pharmaceutical companies such as Johnson & Johnson and Sanofi.
Additional information
Brand | Biotech Peptides |
---|
21 reviews for IGF-1 DES (1mg)
You must be logged in to post a review.
Justin Brand –
You guys are the best!
Colson Winslet –
10/10
Chase Nelson –
Not enough words to express how pleased I am with everything about the experience of buying from Biotech
Juliet Wolf –
For some reason, I expected the products to be a whole lot bigger lol. Probably because of the pictures, but they’re the perfect size
Cora Strand –
I like to do research on companies before I do business with them. So far, I would highly recommend Biotech Peptides to any researcher or company! Products are pure and true!
Ethan Carpio –
Stunning service
Jeffrey Cole –
Ten out of ten would recommend
Carlos Berry –
A very trustworthy company. You can order stress-free
Patty Branco –
Very high quality products. A great find for sure. Definitely making these guys my only supplier.
Oliver Singh –
I am not really the one to leave reviews, but this company deserves all the praise it can get.
Alexis Ogelio –
HAVE BOUGHT PEPTIDES FROM OTHER SOURCES BEFORE THEY CARRY THE BEST IN MY OPINION.
Amber Krauss –
I called them three times and it seemed like they were busy. I called a fourth time a little while after my last try and got a hold of someone named Danni. They explained they have been getting a lot of calls because like me the packages are lost. Hope they change the company they use because this is a big mess and headache for them. Anyway, They are resending all orders with expedited shipping. Fingers crossed I get it in time.
Charlie W. Simons –
Everything came in safe and sound. No broken containers or vials. Nothing looked tampered with or ruined. Wish they had a label on the box however so I knew what the package was initally.
Steve Hogen –
I appreciate how they have articles on their blog about all products they have in stock. Nice way of discovering new peptides.
Malcolm Allen –
Best deal I have found.
David Harold –
Everything came in as advertised and when they said it would be delivered.
burt felix –
Products are amazing, purest I have found thus far. Been working with peptides for a few years now and It’s hard to come by good legit peptides that are also reasonably priced.
Steven robertson –
Good prices for peptides and if you store it correctly these peptides will last for a while.
David Bird –
Orders just came in. Surprised at how fast they arrived as I am based in the east coast!
Bryan Hogan –
Danny and Taylor are my go to for anything.
Jack McLain –
Return time is great! Never a long wait for a response. Danny reached out to me in no time after I sen an e-mail regarding a few missing peptides from my order.